PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA57G00153
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 283aa    MW: 33000 Da    PI: 8.2249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA57G00153genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-1877123148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed +l+++v+q+G + W+ Ia++++ gR +kqc++rw+++l
       AA57G00153  77 KGQWTVDEDRILINLVEQYGLRKWSHIAHMLP-GRIGKQCRERWHNHL 123
                      799*****************************.*************97 PP

2Myb_DNA-binding52.98.5e-17129171145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
       AA57G00153 129 KETWSEEEDRVLIEFHKEIGNK-WAEIAKKLP-GRTENSIKNHWN 171
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.96772127IPR017930Myb domain
SuperFamilySSF466897.55E-3275170IPR009057Homeodomain-like
SMARTSM007172.5E-1776125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2678128IPR009057Homeodomain-like
CDDcd001673.64E-1580123No hitNo description
PfamPF139211.4E-1980138No hitNo description
PROSITE profilePS5129421.121128178IPR017930Myb domain
SMARTSM007175.8E-16128176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-22129177IPR009057Homeodomain-like
CDDcd001676.19E-12131174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGCDHNNNNM MMMMKMMPYD NYGPLEMIKP MNFVMADEVS CVSAEIDLCN KAKTSKPFLT  60
RKTMSFPKDK KKSTLVKGQW TVDEDRILIN LVEQYGLRKW SHIAHMLPGR IGKQCRERWH  120
NHLRPDIKKE TWSEEEDRVL IEFHKEIGNK WAEIAKKLPG RTENSIKNHW NATKRRQFSK  180
RKCRSKFPGA SLLQDYIKSL NLGASSSSLN SSRGRRKKKK KESLVVVAEE EEEEEEERIV  240
PECVLFSDEF GFNEKLLEEG CCIDSLLDDL PHHDHMEAFV HGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-45751782105C-Myb DNA-Binding Domain
1mse_C3e-45751782105C-Myb DNA-Binding Domain
1gv2_A3e-45751782105MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-447517856159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-447517856159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214220RRKKKKK
2214221RRKKKKKE
3215221RKKKKKE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285344.11e-139hypothetical protein CARUB_v10006734mg
SwissprotQ9S7L21e-136MYB98_ARATH; Transcription factor MYB98
TrEMBLR0F8H61e-139R0F8H6_9BRAS; Uncharacterized protein
STRINGscaffold_702543.11e-134(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-110myb domain protein 98